| Desktop | 90/100 | ✔ |
| Mobile | 33/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 339 KB | ✘ |
| Compression | 87 KB (-74.3%) | ✔ |
| Text/Html Ratio | 219 / 347170 (bytes) = 0.06% | ✘ |
| Load Time | 0.11 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 9 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 1 / 2 | ❗ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| merchspotifyapplenewsletterinstagramfacebooktwitterhenryjamisontheyearsavailable | 1 | ✘ | ✘ | ✘ |
| nowstreamselect | 1 | ✘ | ✘ | ✘ |
| intimate | 1 | ✘ | ✘ | ✘ |
| showstouron | 1 | ✘ | ✘ | ✘ |
| sale | 1 | ✘ | ✘ | ✘ |
| nowsubscribe | 1 | ✘ | ✘ | ✘ |
| henry | 1 | ✔ | ✘ | ✘ |
| jamison | 1 | ✔ | ✘ | ✘ |
|
With 0.11 seconds in page load, 339 KB of page size and all other reports below, the henryjamison.com has a SEO score of 57 out of 100 |
| Title | Henry Jamison |
| Description | Official Site |
| Keyword |
| Age | 13 Years, 147 Days |
| Created | 6th-May-2009 |
| Updated | 21st-Apr-2022 |
| Expiry | 6th-May-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| henryjamison.com | A | 3596 | ip:185.230.63.186 |
| henryjamison.com | A | 3596 | ip:185.230.63.107 |
| henryjamison.com | A | 3596 | ip:185.230.63.171 |
| henryjamison.com | NS | 86400 | target:ns1.wixdns.net |
| henryjamison.com | NS | 86400 | target:ns0.wixdns.net |
| henryjamison.com | SOA | 3600 | mname:ns0.wixdns.netrname:support.wix.comserial:2020022623refresh:10800retry:3600expire:604800minimum-ttl:3600 |
| henryjamison.com | MX | 3600 | pri:0target:mail.henryjamison.com |
|
Domain name: henryjamison.com Registry Domain ID: 1554610917_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2022-04-21T16:03:58.64Z Creation Date: 2009-05-06T04:49:28.00Z Registrar Registration Expiration Date: 2023-05-06T04:49:28.00Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.9854014545 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Redacted for Privacy Registrant Organization: Privacy service provided by Withheld for Privacy ehf Registrant Street: Kalkofnsvegur 2 Registrant City: Reykjavik Registrant State/Province: Capital Region Registrant Postal Code: 101 Registrant Country: IS Registrant Phone: +354.4212434 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: 9d6b505df5e74bdf9663880260890b03.protect@withheldforprivacy.com Registry Admin ID: Admin Name: Redacted for Privacy Admin Organization: Privacy service provided by Withheld for Privacy ehf Admin Street: Kalkofnsvegur 2 Admin City: Reykjavik Admin State/Province: Capital Region Admin Postal Code: 101 Admin Country: IS Admin Phone: +354.4212434 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: 9d6b505df5e74bdf9663880260890b03.protect@withheldforprivacy.com Registry Tech ID: Tech Name: Redacted for Privacy Tech Organization: Privacy service provided by Withheld for Privacy ehf Tech Street: Kalkofnsvegur 2 Tech City: Reykjavik Tech State/Province: Capital Region Tech Postal Code: 101 Tech Country: IS Tech Phone: +354.4212434 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: 9d6b505df5e74bdf9663880260890b03.protect@withheldforprivacy.com Name Server: ns0.wixdns.net Name Server: ns1.wixdns.net DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-09-29T14:01:08.05Z |
| Server IP | 185.230.63.171 |
| Server Location | Israel |
| Service Provider | Wix.com Ltd. |
| Domains (TLD) | Status |
|---|---|
| henryjamison.net | Available |
| henryjamison.org | Already Registered |
| henryjamison.biz | Already Registered |
| henryjamison.io | Already Registered |
| henryjamison.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| benryjamison.com | Available |
| genryjamison.com | Available |
| tenryjamison.com | Available |
| yenryjamison.com | Available |
| uenryjamison.com | Available |
| Chowkingusa.com |
| Bobclary.com |
| Akrecapital.com |
| Nocountrymovie.com |
| Charlyndajean.com |
| Siouxspiritualcenter.org |
| Intab.se |
| Presainblugi.com |
| Fabiopotter.com |
| Learngrowfocus.com |